PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG040945t2
Common NameTCM_040945
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-other
Protein Properties Length: 518aa    MW: 58251.4 Da    PI: 6.9955
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG040945t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.62.1e-182075257
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      +kRt  t+ q+ +Le++++++r ps e++++LA++++Lte+q++ WF+ rR k+k+
  Thecc1EG040945t2 20 KKRTVKTPAQVMALENFYKEHRFPSDEMKAQLAAQIRLTEKQISSWFCHRRLKDKR 75
                      8*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-19476IPR009057Homeodomain-like
PROSITE profilePS5007116.2931676IPR001356Homeobox domain
SuperFamilySSF466898.55E-171676IPR009057Homeodomain-like
SMARTSM003896.2E-181880IPR001356Homeobox domain
PfamPF000464.6E-162075IPR001356Homeobox domain
CDDcd000862.21E-172076No hitNo description
PROSITE patternPS0002705174IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MEDSAEVQTE ENKVSLDVNK KRTVKTPAQV MALENFYKEH RFPSDEMKAQ LAAQIRLTEK  60
QISSWFCHRR LKDKRRDESY ANGRQDHSSG VIQDRGSGLR QDSCGSIKQG DYRNVDPREV  120
ESRRIYGHDF PVADLTYERR SHQNPYNAHM EDTSSESSSS LHDQRFSESR DPYDMQISAN  180
LTQNGAITQI KPRIVKSMGY KPSGYLKVKG EMENPAVTAV KRQLGSHYQE DGPLLGIEFD  240
PLPPGAFEFR SSNLVNEPIY VGDPRQEHSP DISGVIKQPN LNIINEVHNP KMSSQASYME  300
DANLNTEHGS DRQDRKSHHQ LKYKSSFLCS NPFPGQNSSI NVYESSAGKT AVSDCKRSRM  360
SFKPAVERMG SDSFSNQPGP YGSKIANEQE KPWLHDDDNH TYKAPKNENL SKTSDLIHGC  420
SESLGTERGP SARMGKLEKL GGEWKPKREY PVRENIDPTN ELKVAKRVKV EFPQQNFVAN  480
ASHSRSLLLT NPTKGSSMDV PSSFSEDETA ETSSSLD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16876RRLKDKRRD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015308.10.0Homeodomain-like superfamily protein, putative isoform 2
TrEMBLA0A061GUR50.0A0A061GUR5_THECC; Homeodomain-like superfamily protein, putative isoform 2
STRINGPOPTR_0009s07600.11e-163(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.14e-95HB-other family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]